PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID FANhyb_rscf00002671.1.g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family Dof
Protein Properties Length: 307aa    MW: 33025.3 Da    PI: 8.9908
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
FANhyb_rscf00002671.1.g00001.1genomekazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-392484262
                          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                    +++alkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  FANhyb_rscf00002671.1.g00001.1 24 QQQALKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 84
                                    7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027017.8E-342682IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-272782IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5252882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGSTTAVGAS RLMEKPGQEQ LQQQQQALKC PRCDSSNTKF CYYNNYSLSQ PRHFCKACKR  60
YWTRGGTLRN VPVGGGCRKN KRVKRPSSTS AVDNGASSSA SSAPNSGNNS NPNPQIDLAS  120
NSNHQHMNPL FYQPDHMGIN PFTTSGFDQF SALGLGFGDQ RFNPAATSKQ IQDLVAANSF  180
HSSNHSIFSS TSYSTAPTMA SVLASKFING GFKDVRGNNN QYFQNLLPFE DLQIAGAGNG  240
GGGGEAVKEV KVEDGGQSRM GWSTNHQANT EQMGFSSDPT LYWISSNLGA NNWHDPANLG  300
SSVSSLI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004293840.10.0PREDICTED: dof zinc finger protein DOF1.4
TrEMBLA0A0B0M5Z56e-90A0A0B0M5Z5_G
STRINGPOPTR_0011s05450.16e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.25e-37Dof family protein